General Information

  • ID:  hor006364
  • Uniprot ID:  P01205
  • Protein name:  Beta-endorphin-2
  • Gene name:  NA
  • Organism:  Oncorhynchus keta (Chum salmon) (Salmo keta)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFMKSWNERSQKPLLTLFKNVIIKDGQQ
  • Length:  30(1-30)
  • Propeptide:  YGGFMKSWNERSQKPLLTLFKNVIIKDGQQ
  • Signal peptide:  NA
  • Modification:  T1 N-acetyltyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01205-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01205-F1.pdbhor006364_AF2.pdbhor006364_ESM.pdb

Physical Information

Mass: 404455 Formula: C161H253N43O44S
Absent amino acids: ACH Common amino acids: K
pI: 10.48 Basic residues: 5
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -66 Boman Index: -4996
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 74.67
Instability Index: 3219.67 Extinction Coefficient cystines: 6990
Absorbance 280nm: 241.03

Literature

  • PubMed ID:  7370035
  • Title:  Occurrence of two different endorphins in the salmon pituitary.